PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_01204-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 132aa    MW: 14351.3 Da    PI: 11.0524
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_01204-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1231.7e-0732742163
                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1 21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                     R RKk+++ e ++ v +L+aeN  L++e+e+l+  +  l +e+
  TRIUR3_01204-P1 32 RSRKKMRLPEVKQLVLSLSAENVGLRQEMESLQRACTGLSKEN 74
                     889*********************************9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.0E-43271No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MAIPFHSTVG SAGGARRTLI LPVPPARTAG QRSRKKMRLP EVKQLVLSLS AENVGLRQEM  60
ESLQRACTGL SKENGRLETR LEHSSSSSKR KRTGSEEEER RQRKPQQAGG GFELPDLNIP  120
AQDVADAPAA VP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13137RSRKKMR
298104ERRQRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3684101e-130AK368410.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2073D08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965736.11e-35PREDICTED: uncharacterized protein LOC101785507 isoform X1
RefseqXP_012701131.11e-35PREDICTED: uncharacterized protein LOC101785507 isoform X2
TrEMBLM8A2S01e-90M8A2S0_TRIUA; Uncharacterized protein
STRINGMLOC_62302.53e-59(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951